PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA05G0018900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 1585aa    MW: 171702 Da    PI: 6.8698
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA05G0018900.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.31.4e-07732774347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +W +eE e++ +  + +G++ +++I++ ++ ++t  +c+++++k+
  ORGLA05G0018900.1 732 PWIQEEKEIFMEKLATFGKD-FSKISSFLQ-HKTTADCIEFYYKH 774
                        899***************99.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.62E-13715777IPR009057Homeodomain-like
PROSITE profilePS5129314.547728779IPR017884SANT domain
SMARTSM007174.8E-7729777IPR001005SANT/Myb domain
PfamPF002499.3E-6732774IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-5732776IPR009057Homeodomain-like
PROSITE profilePS5129313.728937988IPR017884SANT domain
SMARTSM007176.6E-4938986IPR001005SANT/Myb domain
CDDcd001670.00121942980No hitNo description
SuperFamilySSF466891.4E-8942988IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1585 aa     Download sequence    Send to blast
MAAGTTATPS HRQPPRRRDG YYRQGGGSYD RSYPDESLGY TPSRSDRYWL DDDGGGGGGG  60
YKGFSRYGGG GGGGSRRDGR DMRGSYRRSP FRGYGSDFSR NHQEHPPPPL RRSPLRSVAV  120
PMSYDPPGDR ADRGDRDHHH RVTPWRPLRR RESRSDAADA AGAGPVPVGQ AAAAAASEKD  180
VSARSSAVAA PQVSEEEAPR KKPRLGWGQG LAKYEKQKVQ GPAESAEAVA EGSPTATEQK  240
GITHTPAPAP CVSPVAAPSP APCASPVAAP SPAPPCKSPG MQPILTLFSM LKHSFPEDKS  300
CELTANTVTE SNKNIPGPDV QACNNEVPTK LDQLEGDPID SLAKVLSELV QHEDSCSGDS  360
KRLSNVSKLL LLKESISKEL EKTELEIDSL EGELKSVNVE ARNRTLKDPP TAVTYAQNPS  420
PSPVKEQGEL TPSPKISMEQ DADVKGSELM EVETAQAHNA KAVSSEESVA CPGVALGQVP  480
AAADVIPSDP CGKTGSGIDV NIEQREENPC QENFNAMKAD GSSDLATRPC SYREVKYNLM  540
DQIIAANRSE AKKNSQLLFK PVPADRSNLD LLASSYLSSQ MKNDVIIKKK HAILKNRQRF  600
KEQILTFKFR VLRHLWKEDV RLLSVRKQRS KSHKRTDQSN RSSQSGSQRQ RSSNRSRLAV  660
PAGNLSTFPI TEMSGVARKL FSEFQLKRCR NYLKMPALIV DEKEKAGAKF VSKNGLVEDP  720
VSVEKERALI NPWIQEEKEI FMEKLATFGK DFSKISSFLQ HKTTADCIEF YYKHHKSDSF  780
REVKKLLDLR QQQQPASNYL GAVSGKKWNP EANVASLDML GVATEVAAQG LEYVNEVKKN  840
SAKSILRTVC GVDNSTKGSE KDCVGDVSLH ERESVAADVL AGICGTLSPE GMGSCITSSA  900
DPGQKIGIIS RMEHLLTPEA DKNFDDDGTL SDQECEVDIV DWNDDEKSSF IEAMNRYGKD  960
FARISSYVKS KSFEQCKVFF SKARKSLGLD LIHQGAADAG FPTGDANGGR SGTDGACIAE  1020
MDSAICSAQS CPKVEIDACP VSDGEIQGHN PLSDIASRQP EADKSNMPDV VDINVEEGES  1080
KAEKDCSILV DHKQLREDIN QTSCARIDIN CPESTDKLQD IEDVTPVNMH GDDLMATSVE  1140
QVAAAHVESR SSLHSEGIGI DVSRIEGCSH ESTIGKGGKS TPSVCLPAEN GVSKENIIHF  1200
KNMDGASSIS PAFTSNYQQS KLADPIQSKP KPLTPKDLMP VQFSSSLPDP TSICFEGIAA  1260
ITTPNFEDHG NRASIASGAK DVNMFPTFKD QSSNRHDALF SNVDGYMQQR RNNHFGTEVC  1320
GLSESTGISQ SDQFTVSKFQ NGRPSSLGLS NGNLGVLSTG RREEAREGLF RPCSVKTSAG  1380
NEEQQKRPGD VKLFGQILSH QSSLQSSGSS VHGSKSKPPS PKVDKPASSR LLSNPRERLV  1440
YSSRPPIIAN LGLEERAMRS FDHMDGRTIQ PEPMVMVAKC QRPSAGVPVY STKNGALSVF  1500
AEFQQPSMPP HTSDHKLLEN FADLHKRNGI ELLSGFQQPG RLGGAGVLVS GVSDPVAALK  1560
AQYGSGSKML SSSNDVDTWK DIGSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C4e-16690781494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D4e-16690781494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1297200.0AC129720.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0683F12, complete sequence.
GenBankAC1349310.0AC134931.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBb0079L11, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639126.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639127.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639128.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639129.10.0PREDICTED: uncharacterized protein LOC9268524
TrEMBLI1PS410.0I1PS41_ORYGL; Uncharacterized protein
STRINGORGLA05G0018900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.13e-76MYB family protein